- Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF6 (ORF6)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1146426
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 13,626 Da
- E Coli or Yeast
- 1-113
- Uncharacterized protein ORF6 (ORF6)
Sequence
MDMKFWTTKEYKKIKRDFIIRNFAFGFCYFLFLISFIMCIVCFIISINFEVEIILVILFPFLLLILSVWNLFDLIMEHISEIKRFKVTVLKKQIEELEGKMLRGLRVGVDKIE